PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A01041.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 426aa    MW: 46382.3 Da    PI: 6.3107
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A01041.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.9e-1671110140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Pahal.A01041.4  71 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 110
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036384.4E-4122IPR005172CRC domain
SMARTSM011140.32126IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163431.2841111IPR005172CRC domain
SMARTSM011142.0E-1871112IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.3E-1274109IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MYCECFQEQQ FCDGCNCSNC GNIVGNEKAR QEAINAIVQR NPLAFQPKIE NGPSTHNVRK  60
DNSGAVPLVP KHNKGCHCKK SGCLKKYCEC YQANVLCSKN CRCMDCKNFE GSEERKALIQ  120
GDYASDGNQI QQAASVALNG TIGSSGYNCS PVRRKRSHED TLGPRINSEG SMPETQFLQG  180
NHADVSLLAP SSTGFDGHNA ANSQSKSYNP IYRSPLANTI HLTEVNDLVT HMVTACRMAA  240
ATIADNKVNG TTVENQFHVN GGLSNGNCKQ QELKEASQMD ILRRGCSDQP NINEIDSHWS  300
DTAKDSRPAS PTTQALMCDE QETTFGNDYR CSFPSVSCDQ DISEINAAQE NLVLTGLREY  360
LRVIITRGKI KEHKSSSEAA MEPDGQQHHG ATPIAPREVG ENAPSNCAET PRTDQQPTQN  420
AGSER*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR50.0K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-82Tesmin/TSO1-like CXC domain-containing protein